PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_14574_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 393aa    MW: 43558.8 Da    PI: 8.6856
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_14574_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-16125170147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+q+G+ +W++Ia+ +  gR++k+c++rw++ 
   Neem_14574_f_1 125 RGHWRPAEDAKLKELVAQYGPQNWNLIAENLE-GRSGKSCRLRWFNQ 170
                      899*****************************.***********996 PP

2Myb_DNA-binding57.43.3e-18177220146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
   Neem_14574_f_1 177 RRAFTEEEEERLLAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 220
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.784120171IPR017930Myb domain
SMARTSM007171.4E-14124173IPR001005SANT/Myb domain
SuperFamilySSF466892.58E-28125218IPR009057Homeodomain-like
PfamPF002495.2E-16125170IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-26126178IPR009057Homeodomain-like
CDDcd001671.41E-13128169No hitNo description
PROSITE profilePS5129427.671172226IPR017930Myb domain
SMARTSM007172.2E-15176224IPR001005SANT/Myb domain
PfamPF002491.2E-14177219IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-21179225IPR009057Homeodomain-like
CDDcd001671.51E-7188219No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MSLQHLKNDA NVFNGVHQEI NFLAPPPSRL SLSNNFGAMG GHPKIRKINN PEMGFQILDS  60
SMEKAMEPWV GLKPVENRGA KRTVDEREGI FGVDKKGLCL NLGEEVEEVK RSGTGRNGHT  120
KLCARGHWRP AEDAKLKELV AQYGPQNWNL IAENLEGRSG KSCRLRWFNQ LDPRINRRAF  180
TEEEEERLLA AHRLYGNKWA MIARLFPGRT DNAVKNHWHV IMARKHREQS SIYRRRKPSA  240
VAQVVPRGLD MNFQNNACSE STISSNNESA STITDLSLTP SSAKVTPGYF TKLSLMGCSS  300
GKKEITTGNG DIDKIYDTGN EFYQAGSIGV VMGVDQSGNS SDSNSEVSAT ESVANNTTTT  360
NNNKTNLSTY GENENSYEKI NMPFIDFLGV GAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-331252257107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006443531.11e-179hypothetical protein CICLE_v10020631mg
RefseqXP_006479198.11e-179PREDICTED: myb-like protein AA
TrEMBLV4U3P01e-179V4U3P0_9R
STRINGPOPTR_0013s06320.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-69myb domain protein 105